SCOPe 2.07: Domain d3x0qa_: 3x0q A:

Lineage for d3x0qa_ (3x0q A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein ADP-ribose pyrophosphatase [64365] (4 species)

7. Species Thermus thermophilus [TaxId:300852] [316338] (9 PDB entries)

8. Domain d3x0qa_: 3x0q A: [316354]
   automated match to d1v8ia_
   complexed with ar6, gol, mn, so4

Details for d3x0qa_

PDB Entry: 3x0q, 1.14 Å

PDB Description: adp ribose pyrophosphatase from thermus thermophilus hb8 in esmm-state at reaction time of 20 min

PDB Compounds: (A:) ADP-ribose pyrophosphatase

SCOPe Domain Sequences for d3x0qa_:

Sequence, based on SEQRES records:

>d3x0qa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 300852]}
ertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipagli
epgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveahpdede
aievvwmrpeealerhqrgevefsatglvgvlyyhaflr

Sequence, based on observed residues (ATOM records):

>d3x0qa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 300852]}
ertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipagli
epgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveaeaievv
wmrpeealerhqrgevefsatglvgvlyyhaflr

Timeline for d3x0qa_:

• d3x0qa_ first appeared in SCOPe 2.06
  
• d3x0qa_ appears in the current release, SCOPe 2.08