Lineage for d1efpa1 (1efp A:2-184)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69097Fold c.29: ETFP adenine nucleotide-binding domain-like [52430] (1 superfamily)
  4. 69098Superfamily c.29.1: ETFP adenine nucleotide-binding domain-like [52431] (2 families) (S)
  5. 69099Family c.29.1.1: Electron transfer flavoprotein, ETFP [52432] (1 protein)
  6. 69100Protein Electron transfer flavoprotein, ETFP [52433] (2 species)
  7. 69104Species Paracoccus denitrificans [TaxId:266] [52435] (1 PDB entry)
  8. 69105Domain d1efpa1: 1efp A:2-184 [31635]
    Other proteins in same PDB: d1efpa2, d1efpc2

Details for d1efpa1

PDB Entry: 1efp (more details), 2.6 Å

PDB Description: electron transfer flavoprotein (etf) from paracoccus denitrificans

SCOP Domain Sequences for d1efpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efpa1 c.29.1.1 (A:2-184) Electron transfer flavoprotein, ETFP {Paracoccus denitrificans}
avlllgevtngalnrdatakavaavkalgdvtvlcagasakaaaeeaakiagvakvlvae
dalyghrlaeptaalivglagdyshiaapattdaknvmprvaalldvmvlsdvsaildad
tferpiyagnaiqvvkskdakkvftirtasfdaageggtapvtetaaaadpglsswvade
vae

SCOP Domain Coordinates for d1efpa1:

Click to download the PDB-style file with coordinates for d1efpa1.
(The format of our PDB-style files is described here.)

Timeline for d1efpa1: