Lineage for d3x0ia_ (3x0i A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2577869Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2578012Protein ADP-ribose pyrophosphatase [64365] (4 species)
  7. 2578031Species Thermus thermophilus [TaxId:274] [118083] (13 PDB entries)
    Uniprot Q84CU3
  8. 2578032Domain d3x0ia_: 3x0i A: [316341]
    automated match to d1v8ia_
    complexed with gol, so4

Details for d3x0ia_

PDB Entry: 3x0i (more details), 0.91 Å

PDB Description: adp ribose pyrophosphatase in apo state at 0.91 angstrom resolution
PDB Compounds: (A:) ADP-ribose pyrophosphatase

SCOPe Domain Sequences for d3x0ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x0ia_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}
ertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipagli
epgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveahpdede
aievvwmrpeealerhqrgevefsatglvgvlyyhaflr

SCOPe Domain Coordinates for d3x0ia_:

Click to download the PDB-style file with coordinates for d3x0ia_.
(The format of our PDB-style files is described here.)

Timeline for d3x0ia_: