| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
| Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
| Protein automated matches [254493] (6 species) not a true protein |
| Species Horse (Equus caballus) [TaxId:9796] [256129] (26 PDB entries) |
| Domain d5ijea3: 5ije A:388-583 [316335] automated match to d1hk2a3 complexed with so4, zn |
PDB Entry: 5ije (more details), 2.4 Å
SCOPe Domain Sequences for d5ijea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ijea3 a.126.1.0 (A:388-583) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kkncdlfeevgeydfqnalivrytkkapqvstptlveigrtlgkvgsrccklpeserlpc
senhlalalnrlcvlhektpvsekitkcctdslaerrpcfsaleldegyvpkefkaetft
fhadictlpedekqikkqsalaelvkhkpkatkeqlktvlgnfsafvakccgaedkeacf
aeegpklvassqlala
Timeline for d5ijea3: