Lineage for d1efva1 (1efv A:20-207)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2469527Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2469682Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 2469683Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
    contains an additional FAD-binding domain of DHS-like fold
  7. 2469684Species Human (Homo sapiens) [TaxId:9606] [81389] (2 PDB entries)
    Uniprot P13804 20-203
  8. 2469685Domain d1efva1: 1efv A:20-207 [31633]
    Other proteins in same PDB: d1efva2, d1efvb_
    complexed with amp, fad

Details for d1efva1

PDB Entry: 1efv (more details), 2.1 Å

PDB Description: three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution
PDB Compounds: (A:) electron transfer flavoprotein

SCOPe Domain Sequences for d1efva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efva1 c.26.2.3 (A:20-207) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlva
qhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiaik
spdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveisew
ldqkltks

SCOPe Domain Coordinates for d1efva1:

Click to download the PDB-style file with coordinates for d1efva1.
(The format of our PDB-style files is described here.)

Timeline for d1efva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1efva2
View in 3D
Domains from other chains:
(mouse over for more information)
d1efvb_