Lineage for d1efva1 (1efv A:20-207)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22627Fold c.29: ETFP adenine nucleotide-binding domain-like [52430] (1 superfamily)
  4. 22628Superfamily c.29.1: ETFP adenine nucleotide-binding domain-like [52431] (2 families) (S)
  5. 22629Family c.29.1.1: Electron transfer flavoprotein, ETFP [52432] (1 protein)
  6. 22630Protein Electron transfer flavoprotein, ETFP [52433] (2 species)
  7. 22631Species Human (Homo sapiens) [TaxId:9606] [52434] (1 PDB entry)
  8. 22632Domain d1efva1: 1efv A:20-207 [31633]
    Other proteins in same PDB: d1efva2

Details for d1efva1

PDB Entry: 1efv (more details), 2.1 Å

PDB Description: three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution

SCOP Domain Sequences for d1efva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efva1 c.29.1.1 (A:20-207) Electron transfer flavoprotein, ETFP {Human (Homo sapiens)}
qstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlva
qhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiaik
spdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveisew
ldqkltks

SCOP Domain Coordinates for d1efva1:

Click to download the PDB-style file with coordinates for d1efva1.
(The format of our PDB-style files is described here.)

Timeline for d1efva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1efva2
View in 3D
Domains from other chains:
(mouse over for more information)
d1efvb1