Lineage for d5fvlb_ (5fvl B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696892Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 2696909Family a.7.14.0: automated matches [191520] (1 protein)
    not a true family
  6. 2696910Protein automated matches [190877] (3 species)
    not a true protein
  7. 2696911Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188239] (3 PDB entries)
  8. 2696915Domain d5fvlb_: 5fvl B: [316326]
    Other proteins in same PDB: d5fvla2
    automated match to d4niqa_

Details for d5fvlb_

PDB Entry: 5fvl (more details), 1.97 Å

PDB Description: crystal structure of vps4-vps20 complex from s.cerevisiae
PDB Compounds: (B:) vacuolar protein sorting-associated protein 4

SCOPe Domain Sequences for d5fvlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fvlb_ a.7.14.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakftey
lnraeqlkkhleseeana

SCOPe Domain Coordinates for d5fvlb_:

Click to download the PDB-style file with coordinates for d5fvlb_.
(The format of our PDB-style files is described here.)

Timeline for d5fvlb_: