Lineage for d1qnfa2 (1qnf A:1-204)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828112Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 828113Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family) (S)
  5. 828114Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins)
  6. 828122Protein DNA photolyase [52427] (3 species)
    binds a light-harvesting cofactor
  7. 828126Species Synechococcus elongatus [TaxId:32046] [52429] (7 PDB entries)
    Uniprot P05327 1-474
    cofactor is HDF
  8. 828132Domain d1qnfa2: 1qnf A:1-204 [31632]
    Other proteins in same PDB: d1qnfa1
    complexed with fad, hdf

Details for d1qnfa2

PDB Entry: 1qnf (more details), 1.8 Å

PDB Description: structure of photolyase
PDB Compounds: (A:) photolyase

SCOP Domain Sequences for d1qnfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnfa2 c.28.1.1 (A:1-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]}
maapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclq
elqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalkta
giravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlt
aiaplllselptlkqlgfdwdggf

SCOP Domain Coordinates for d1qnfa2:

Click to download the PDB-style file with coordinates for d1qnfa2.
(The format of our PDB-style files is described here.)

Timeline for d1qnfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qnfa1