| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family) ![]() |
| Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins) |
| Protein DNA photolyase [52427] (3 species) binds a light-harvesting cofactor |
| Species Anacystis nidulans [52429] (6 PDB entries) cofactor is HDF |
| Domain d1qnf_2: 1qnf 1-204 [31632] Other proteins in same PDB: d1qnf_1 |
PDB Entry: 1qnf (more details), 1.8 Å
SCOP Domain Sequences for d1qnf_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnf_2 c.28.1.1 (1-204) DNA photolyase {Anacystis nidulans}
maapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclq
elqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalkta
giravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlt
aiaplllselptlkqlgfdwdggf
Timeline for d1qnf_2: