Lineage for d1qnf_2 (1qnf 1-204)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69088Fold c.28: N-terminal domain of DNA photolyase [52424] (1 superfamily)
  4. 69089Superfamily c.28.1: N-terminal domain of DNA photolyase [52425] (1 family) (S)
  5. 69090Family c.28.1.1: N-terminal domain of DNA photolyase [52426] (1 protein)
  6. 69091Protein N-terminal domain of DNA photolyase [52427] (2 species)
  7. 69092Species Anacystis nidulans [52429] (1 PDB entry)
  8. 69093Domain d1qnf_2: 1qnf 1-204 [31632]
    Other proteins in same PDB: d1qnf_1

Details for d1qnf_2

PDB Entry: 1qnf (more details), 1.8 Å

PDB Description: structure of photolyase

SCOP Domain Sequences for d1qnf_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnf_2 c.28.1.1 (1-204) N-terminal domain of DNA photolyase {Anacystis nidulans}
maapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclq
elqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalkta
giravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlt
aiaplllselptlkqlgfdwdggf

SCOP Domain Coordinates for d1qnf_2:

Click to download the PDB-style file with coordinates for d1qnf_2.
(The format of our PDB-style files is described here.)

Timeline for d1qnf_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qnf_1