![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) ![]() |
![]() | Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
![]() | Protein automated matches [190983] (9 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [316242] (3 PDB entries) |
![]() | Domain d5dqvb_: 5dqv B: [316313] automated match to d3djba1 complexed with ni |
PDB Entry: 5dqv (more details), 2 Å
SCOPe Domain Sequences for d5dqvb_:
Sequence, based on SEQRES records: (download)
>d5dqvb_ a.211.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} mtelkqadqirtwvqsvltgessghdwlhisrvadlavyigekenadlfivetaalvhdl idvklpdtirlsvsevynqlvtfgigkedadrvihiitkmsfrdreklegeplsiegkvv qdadrldaigavgiarafmfagakghglygddqsayahffhkllrlidmmntdtarelae erhefmlqyirqlekdipgid
>d5dqvb_ a.211.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} mtelkqadqirtwvqsvldwlhisrvadlavyigekenadlfivetaalvhdlidvklpt irlsvsevynqlvtfgigkedadrvihiitkmsfrdrlsiegkvvqdadrldaigavgia rafmfagakghglygddqsayahffhkllrlidmmntdtarelaeerhefmlqyirqlek dipgid
Timeline for d5dqvb_: