Lineage for d1dnpb2 (1dnp B:1-200)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470051Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2470052Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 2470053Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins)
  6. 2470065Protein DNA photolyase [52427] (3 species)
    binds a light-harvesting cofactor
  7. 2470066Species Escherichia coli [TaxId:562] [52428] (1 PDB entry)
    cofactor is MHTF
  8. 2470068Domain d1dnpb2: 1dnp B:1-200 [31631]
    Other proteins in same PDB: d1dnpa1, d1dnpb1
    complexed with fad, mhf

Details for d1dnpb2

PDB Entry: 1dnp (more details), 2.3 Å

PDB Description: structure of deoxyribodipyrimidine photolyase
PDB Compounds: (B:) DNA photolyase

SCOPe Domain Sequences for d1dnpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dnpb2 c.28.1.1 (B:1-200) DNA photolyase {Escherichia coli [TaxId: 562]}
tthlvwfrqdlrlhdnlalaaacrnssarvlalyiatprqwathnmsprqaelinaqlng
lqialaekgipllfrevddfvasveivkqvcaensvthlfynyqyevnerardveveral
rnvvcegfddsvilppgavmtgnhemykvftpfknawlkrlregmpecvaapkvrssgsi
epspsitlnyprqsfdtahf

SCOPe Domain Coordinates for d1dnpb2:

Click to download the PDB-style file with coordinates for d1dnpb2.
(The format of our PDB-style files is described here.)

Timeline for d1dnpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dnpb1