Lineage for d1dnpb2 (1dnp B:1-200)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178711Fold c.28: N-terminal domain of DNA photolyase [52424] (1 superfamily)
  4. 178712Superfamily c.28.1: N-terminal domain of DNA photolyase [52425] (1 family) (S)
  5. 178713Family c.28.1.1: N-terminal domain of DNA photolyase [52426] (1 protein)
  6. 178714Protein N-terminal domain of DNA photolyase [52427] (3 species)
  7. 178717Species Escherichia coli [TaxId:562] [52428] (1 PDB entry)
  8. 178719Domain d1dnpb2: 1dnp B:1-200 [31631]
    Other proteins in same PDB: d1dnpa1, d1dnpb1

Details for d1dnpb2

PDB Entry: 1dnp (more details), 2.3 Å

PDB Description: structure of deoxyribodipyrimidine photolyase

SCOP Domain Sequences for d1dnpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dnpb2 c.28.1.1 (B:1-200) N-terminal domain of DNA photolyase {Escherichia coli}
tthlvwfrqdlrlhdnlalaaacrnssarvlalyiatprqwathnmsprqaelinaqlng
lqialaekgipllfrevddfvasveivkqvcaensvthlfynyqyevnerardveveral
rnvvcegfddsvilppgavmtgnhemykvftpfknawlkrlregmpecvaapkvrssgsi
epspsitlnyprqsfdtahf

SCOP Domain Coordinates for d1dnpb2:

Click to download the PDB-style file with coordinates for d1dnpb2.
(The format of our PDB-style files is described here.)

Timeline for d1dnpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dnpb1