Lineage for d5ftza_ (5ftz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766541Species Streptomyces lividans [TaxId:1200984] [316308] (1 PDB entry)
  8. 2766542Domain d5ftza_: 5ftz A: [316309]
    automated match to d2bema_
    complexed with cu

Details for d5ftza_

PDB Entry: 5ftz (more details), 1.38 Å

PDB Description: aa10 lytic polysaccharide monooxygenase (lpmo) from streptomyces lividans
PDB Compounds: (A:) chitin binding protein

SCOPe Domain Sequences for d5ftza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ftza_ b.1.18.0 (A:) automated matches {Streptomyces lividans [TaxId: 1200984]}
hgytdlpvsrqkvcqngtvggcgaiqwepqsvegpkgfpasgpadgticsaghgsfaald
spkqpngqawpttrvnggqsytfrwqftarhattdfkyyvtkpgwnqnhnlarsdlnltp
fftvpyggkqppatlshsgtlpsglsghhvilavwtvhdtgnafyacsdvtf

SCOPe Domain Coordinates for d5ftza_:

Click to download the PDB-style file with coordinates for d5ftza_.
(The format of our PDB-style files is described here.)

Timeline for d5ftza_: