Lineage for d5f6ea_ (5f6e A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939126Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (29 PDB entries)
    identical sequence in many other species
  8. 2939127Domain d5f6ea_: 5f6e A: [316302]
    automated match to d1u9aa_
    complexed with edo

Details for d5f6ea_

PDB Entry: 5f6e (more details), 1.12 Å

PDB Description: crystal structure of human ubc9 (k48a/k49a/e54a)
PDB Compounds: (A:) SUMO-conjugating enzyme UBC9

SCOPe Domain Sequences for d5f6ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f6ea_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]}
sgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgaagtpwagglfklr
mlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqelln
epniqdpaqaeaytiycqnrveyekrvraqakkfap

SCOPe Domain Coordinates for d5f6ea_:

Click to download the PDB-style file with coordinates for d5f6ea_.
(The format of our PDB-style files is described here.)

Timeline for d5f6ea_: