![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
![]() | Family c.84.1.0: automated matches [254314] (1 protein) not a true family |
![]() | Protein automated matches [254721] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [316254] (14 PDB entries) |
![]() | Domain d5hshb2: 5hsh B:192-304 [316298] Other proteins in same PDB: d5hsha4, d5hshb4 automated match to d3pmga2 complexed with so4; mutant |
PDB Entry: 5hsh (more details), 2.65 Å
SCOPe Domain Sequences for d5hshb2:
Sequence, based on SEQRES records: (download)
>d5hshb2 c.84.1.0 (B:192-304) automated matches {Human (Homo sapiens) [TaxId: 9606]} veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdrdrnmilgkhgffv
>d5hshb2 c.84.1.0 (B:192-304) automated matches {Human (Homo sapiens) [TaxId: 9606]} veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc vaadlvetmksgehdfgaafdgdrdrnmilgkhgffv
Timeline for d5hshb2:
![]() Domains from other chains: (mouse over for more information) d5hsha1, d5hsha2, d5hsha3, d5hsha4 |