Lineage for d1brwb2 (1brw B:1071-1330)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106674Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2106675Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2106676Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 protein domains)
  6. 2106719Protein Pyrimidine nucleoside phosphorylase [52422] (1 species)
  7. 2106720Species Bacillus stearothermophilus [TaxId:1422] [52423] (1 PDB entry)
  8. 2106722Domain d1brwb2: 1brw B:1071-1330 [31629]
    Other proteins in same PDB: d1brwa1, d1brwa3, d1brwb1, d1brwb3
    complexed with ca, mes, po4, ura

Details for d1brwb2

PDB Entry: 1brw (more details), 2.1 Å

PDB Description: the crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation
PDB Compounds: (B:) protein (pyrimidine nucleoside phosphorylase)

SCOPe Domain Sequences for d1brwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brwb2 c.27.1.1 (B:1071-1330) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]}
lssirgvkvdkhstggvgdtttlvlgplvasvgvpvakmsgrglghtggtidklesvpgf
hveiskdefirlvnengiaiigqtgdltpadkklyalrdvtatvnsipliassimskkia
agadaivldvktgagafmkkldearrlarvmvdigkrvgrrtmavisdmsqplgyavgna
levkeaietlkgngphdltelcltlgshmvylaekapsldearrlleeairsgaaiaafk
tflaaqggdasvvddldklp

SCOPe Domain Coordinates for d1brwb2:

Click to download the PDB-style file with coordinates for d1brwb2.
(The format of our PDB-style files is described here.)

Timeline for d1brwb2: