Lineage for d5fdfb_ (5fdf B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509052Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 2509053Protein Acetyl xylan esterase TM0077 [110693] (1 species)
  7. 2509054Species Thermotoga maritima [TaxId:2336] [110694] (5 PDB entries)
    Uniprot Q9WXT2
  8. 2509056Domain d5fdfb_: 5fdf B: [316289]
    automated match to d1vlqa_
    complexed with act, cl

Details for d5fdfb_

PDB Entry: 5fdf (more details), 1.76 Å

PDB Description: crystal structure of the monoclinic form of thermotoga maritima acetyl esterase tm0077 (apo structure) at 1.76 angstrom resolution
PDB Compounds: (B:) Cephalosporin-C deacetylase

SCOPe Domain Sequences for d5fdfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fdfb_ c.69.1.25 (B:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]}
fdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfsg
yrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgsg
wlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqeriv
iaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdke
eivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnh
egggsfqaveqvkflkklfe

SCOPe Domain Coordinates for d5fdfb_:

Click to download the PDB-style file with coordinates for d5fdfb_.
(The format of our PDB-style files is described here.)

Timeline for d5fdfb_: