Lineage for d5dqwa_ (5dqw A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2350180Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2350181Protein automated matches [190983] (10 species)
    not a true protein
  7. 2350188Species Bacillus subtilis [TaxId:1423] [316242] (3 PDB entries)
  8. 2350191Domain d5dqwa_: 5dqw A: [316276]
    automated match to d3djba1
    complexed with adp, ni

Details for d5dqwa_

PDB Entry: 5dqw (more details), 2.15 Å

PDB Description: the crystal structure of bacillus subtilis ypgq in complex with adp
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5dqwa_:

Sequence, based on SEQRES records: (download)

>d5dqwa_ a.211.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mtelkqadqirtwvqsvltgessghdwlhisrvadlavyigekenadlfivetaalvhdl
idvklpdtirlsvsevynqlvtfgigkedadrvihiitkmsfrdreklegeplsiegkvv
qdadrldaigavgiarafmfagakghglygddqsayahffhkllrlidmmntdtarelae
erhefmlqyirqlekdipgida

Sequence, based on observed residues (ATOM records): (download)

>d5dqwa_ a.211.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mtelkqadqirtwvqsvltghdwlhisrvadlavyigekenadlfivetaalvhdlidvk
lpdtirlsvsevynqlvtfgigkedadrvihiitkmsplsiegkvvqdadrldaigavgi
arafmfagakghglygddqsayahffhkllrlidmmntdtarelaeerhefmlqyirqle
kdipgida

SCOPe Domain Coordinates for d5dqwa_:

Click to download the PDB-style file with coordinates for d5dqwa_.
(The format of our PDB-style files is described here.)

Timeline for d5dqwa_: