![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
![]() | Protein automated matches [190983] (12 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [316242] (3 PDB entries) |
![]() | Domain d5dqwa_: 5dqw A: [316276] automated match to d3djba1 complexed with adp, ni |
PDB Entry: 5dqw (more details), 2.15 Å
SCOPe Domain Sequences for d5dqwa_:
Sequence, based on SEQRES records: (download)
>d5dqwa_ a.211.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} mtelkqadqirtwvqsvltgessghdwlhisrvadlavyigekenadlfivetaalvhdl idvklpdtirlsvsevynqlvtfgigkedadrvihiitkmsfrdreklegeplsiegkvv qdadrldaigavgiarafmfagakghglygddqsayahffhkllrlidmmntdtarelae erhefmlqyirqlekdipgida
>d5dqwa_ a.211.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} mtelkqadqirtwvqsvltghdwlhisrvadlavyigekenadlfivetaalvhdlidvk lpdtirlsvsevynqlvtfgigkedadrvihiitkmsplsiegkvvqdadrldaigavgi arafmfagakghglygddqsayahffhkllrlidmmntdtarelaeerhefmlqyirqle kdipgida
Timeline for d5dqwa_: