SCOP 1.67: Domain d1azya2: 1azy A:71-335

Lineage for d1azya2 (1azy A:71-335)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (1 family)

5. Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (3 proteins)

6. Protein Thymidine phosphorylase [52420] (2 species)

7. Species Escherichia coli [TaxId:562] [52421] (4 PDB entries)

8. Domain d1azya2: 1azy A:71-335 [31625]
   Other proteins in same PDB: d1azya1, d1azya3, d1azyb1, d1azyb3

Details for d1azya2

PDB Entry: 1azy, 3 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase

SCOP Domain Sequences for d1azya2:

Sequence; same for both SEQRES and ATOM records:

>d1azya2 c.27.1.1 (A:71-335) Thymidine phosphorylase {Escherichia coli}
dwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglghtggtldklesi
pgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsiplitasilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearaklqavldngkaa
evfgrmvaaqkgptdfvenyakylp

Timeline for d1azya2:

• d1azya2 first appeared (with stable ids) in SCOP 1.55
  
• d1azya2 appears in SCOP 1.65
  
• d1azya2 appears in SCOP 1.69
  
• d1azya2 appears in the current release, SCOPe 2.08