Lineage for d5dqva_ (5dqv A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342564Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2342565Protein automated matches [190983] (9 species)
    not a true protein
  7. 2342572Species Bacillus subtilis [TaxId:1423] [316242] (3 PDB entries)
  8. 2342573Domain d5dqva_: 5dqv A: [316243]
    automated match to d3djba1
    complexed with ni

Details for d5dqva_

PDB Entry: 5dqv (more details), 2 Å

PDB Description: the crystal structure of bacillus subtilis ypgq
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5dqva_:

Sequence, based on SEQRES records: (download)

>d5dqva_ a.211.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mtelkqadqirtwvqsvltgessghdwlhisrvadlavyigekenadlfivetaalvhdl
idvklpdtirlsvsevynqlvtfgigkedadrvihiitkmsfrdreklegeplsiegkvv
qdadrldaigavgiarafmfagakghglygddqsayahffhkllrlidmmntdtarelae
erhefmlqyirqlekdipgidakt

Sequence, based on observed residues (ATOM records): (download)

>d5dqva_ a.211.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mtelkqadqirtwvqsvltdwlhisrvadlavyigekenadlfivetaalvhdlidvklp
dtirlsvsevynqlvtfgigkedadrvihiitkmsplsiegkvvqdadrldaigavgiar
afmfagakghglygddqsayahffhkllrlidmmntdtarelaeerhefmlqyirqlekd
ipgidakt

SCOPe Domain Coordinates for d5dqva_:

Click to download the PDB-style file with coordinates for d5dqva_.
(The format of our PDB-style files is described here.)

Timeline for d5dqva_: