Lineage for d1otpa2 (1otp A:71-335)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2469961Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2469962Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2469963Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins)
  6. 2470010Protein Thymidine phosphorylase [52420] (2 species)
  7. 2470011Species Escherichia coli [TaxId:562] [52421] (7 PDB entries)
  8. 2470016Domain d1otpa2: 1otp A:71-335 [31624]
    Other proteins in same PDB: d1otpa1, d1otpa3, d1otpa4

Details for d1otpa2

PDB Entry: 1otp (more details), 2.8 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d1otpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otpa2 c.27.1.1 (A:71-335) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
dwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglghtggtldklesi
pgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsiplitasilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearaklqavldngkaa
evfgrmvaaqkgptdfvenyakylp

SCOPe Domain Coordinates for d1otpa2:

Click to download the PDB-style file with coordinates for d1otpa2.
(The format of our PDB-style files is described here.)

Timeline for d1otpa2: