SCOP 1.73: Domain d1otpa2: 1otp A:71-335

Lineage for d1otpa2 (1otp A:71-335)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (1 family)

5. Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (3 proteins)

6. Protein Thymidine phosphorylase [52420] (2 species)

7. Species Escherichia coli [TaxId:562] [52421] (4 PDB entries)

8. Domain d1otpa2: 1otp A:71-335 [31624]
   Other proteins in same PDB: d1otpa1, d1otpa3

Details for d1otpa2

PDB Entry: 1otp, 2.8 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase

PDB Compounds: (A:) thymidine phosphorylase

SCOP Domain Sequences for d1otpa2:

Sequence; same for both SEQRES and ATOM records:

>d1otpa2 c.27.1.1 (A:71-335) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
dwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglghtggtldklesi
pgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsiplitasilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearaklqavldngkaa
evfgrmvaaqkgptdfvenyakylp

Timeline for d1otpa2:

• d1otpa2 first appeared (with stable ids) in SCOP 1.55, called d1otp_2
  
• d1otpa2 was called d1otp_2 in SCOP 1.71
  
• d1otpa2 appears in SCOP 1.75
  
• d1otpa2 appears in the current release, SCOPe 2.08