![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (44 species) not a true protein |
![]() | Species Amphitrite ornata [TaxId:129555] [189339] (41 PDB entries) |
![]() | Domain d5chqb_: 5chq B: [316237] automated match to d3ixfa_ complexed with gol, hem, npo, so4 |
PDB Entry: 5chq (more details), 1.87 Å
SCOPe Domain Sequences for d5chqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5chqb_ a.1.1.2 (B:) automated matches {Amphitrite ornata [TaxId: 129555]} gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw drfgknlvsalssagmk
Timeline for d5chqb_: