SCOPe 2.07: Domain d5c16d2: 5c16 D:220-605

Lineage for d5c16d2 (5c16 D:220-605)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.3: Myotubularin-like phosphatases [102422] (2 proteins)
   common fold is decorated with additional structures

6. Protein automated matches [316214] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [316215] (1 PDB entry)

8. Domain d5c16d2: 5c16 D:220-605 [316234]
   Other proteins in same PDB: d5c16a1, d5c16b1, d5c16c1, d5c16d1
   automated match to d1zvra2
   complexed with po4

Details for d5c16d2

PDB Entry: 5c16, 2.07 Å

PDB Description: myotubularin-related proetin 1

PDB Compounds: (D:) Myotubularin-related protein 1

SCOPe Domain Sequences for d5c16d2:

Sequence; same for both SEQRES and ATOM records:

>d5c16d2 c.45.1.3 (D:220-605) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekfpingwkvydpvseykrqglpneswkiskinsnyefcdtypaiivvptsvkdddlskv
aafrakgrvpvlswihpesqatitrcsqplvgpndkrckedekylqtimdanaqshklii
fdarqnsvadtnktkgggyesesaypnaelvfleihnihvmreslrklkeivypsidear
wlsnvdgthwleyirmllagavriadkiesgktsvvvhssdgwdrtaqltslamlmldsy
yrtikgfetlvekewisfghrfalrvghgndnhadadrspiflqfvdcvwqmtrqfpsaf
efnelflitildhlysclfgtflcnceqqrfkedvytktislwsyinsqldefsnpffvn
yenhvlypvaslshlelwvnyyvrwn

Timeline for d5c16d2:

• d5c16d2 first appeared in SCOPe 2.06
  
• d5c16d2 appears in the current release, SCOPe 2.08