Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (4 families) duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins) contains metal-binding preSET and postSET domains |
Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82206] (19 PDB entries) Uniprot Q8WTS6 52-336 |
Domain d5ayfa2: 5ayf A:194-366 [316227] Other proteins in same PDB: d5ayfa1 automated match to d4jdsa2 complexed with c7h, sam, trs |
PDB Entry: 5ayf (more details), 2.01 Å
SCOPe Domain Sequences for d5ayfa2:
Sequence, based on SEQRES records: (download)
>d5ayfa2 b.85.7.1 (A:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf gpikcirtlraveadeeltvaygxxxxxxxxxxxxxpewyqvelkafqatqqk
>d5ayfa2 b.85.7.1 (A:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf gpikcirtlraveadeeltvaygxxxxxxpewyqvelkafqatqqk
Timeline for d5ayfa2: