SCOPe 2.06: Domain d5ayfa2: 5ayf A:194-366

Lineage for d5ayfa2 (5ayf A:194-366)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
   contains metal-binding preSET and postSET domains

6. Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82206] (18 PDB entries)
   Uniprot Q8WTS6 52-336

8. Domain d5ayfa2: 5ayf A:194-366 [316227]
   Other proteins in same PDB: d5ayfa1
   automated match to d4jdsa2
   complexed with c7h, sam, trs

Details for d5ayfa2

PDB Entry: 5ayf, 2.01 Å

PDB Description: crystal structure of set7/9 in complex with cyproheptadine

PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d5ayfa2:

Sequence, based on SEQRES records:

>d5ayfa2 b.85.7.1 (A:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygxxxxxxxxxxxxxpewyqvelkafqatqqk

Sequence, based on observed residues (ATOM records):

>d5ayfa2 b.85.7.1 (A:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygxxxxxxpewyqvelkafqatqqk

Timeline for d5ayfa2:

• d5ayfa2 is new in SCOPe 2.06-stable
  
• d5ayfa2 appears in SCOPe 2.07
  
• d5ayfa2 appears in the current release, SCOPe 2.08