Lineage for d5ayfa1 (5ayf A:116-193)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2078985Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2079020Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 2079021Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 2079022Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 2079023Species Human (Homo sapiens) [TaxId:9606] [82188] (18 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 2079043Domain d5ayfa1: 5ayf A:116-193 [316224]
    Other proteins in same PDB: d5ayfa2
    automated match to d3cbpa1
    complexed with c7h, sam, trs

Details for d5ayfa1

PDB Entry: 5ayf (more details), 2.01 Å

PDB Description: crystal structure of set7/9 in complex with cyproheptadine
PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d5ayfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ayfa1 b.76.2.1 (A:116-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
eegrphfelmpgnsvyhf

SCOPe Domain Coordinates for d5ayfa1:

Click to download the PDB-style file with coordinates for d5ayfa1.
(The format of our PDB-style files is described here.)

Timeline for d5ayfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ayfa2