SCOPe 2.06: Domain d5ayfa1: 5ayf A:116-193

Lineage for d5ayfa1 (5ayf A:116-193)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family)
   11+ stranded sheet partly folded upon itself at the C-end

5. Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)

6. Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82188] (18 PDB entries)
   Uniprot Q8WTS6 52-366

8. Domain d5ayfa1: 5ayf A:116-193 [316224]
   Other proteins in same PDB: d5ayfa2
   automated match to d3cbpa1
   complexed with c7h, sam, trs

Details for d5ayfa1

PDB Entry: 5ayf, 2.01 Å

PDB Description: crystal structure of set7/9 in complex with cyproheptadine

PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d5ayfa1:

Sequence; same for both SEQRES and ATOM records:

>d5ayfa1 b.76.2.1 (A:116-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
eegrphfelmpgnsvyhf

Timeline for d5ayfa1:

• d5ayfa1 is new in SCOPe 2.06-stable
  
• d5ayfa1 appears in SCOPe 2.07
  
• d5ayfa1 appears in the current release, SCOPe 2.08