![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (27 families) ![]() |
![]() | Family a.118.1.1: Armadillo repeat [48372] (7 proteins) this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain |
![]() | Protein Importin alpha [48376] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [48377] (35 PDB entries) |
![]() | Domain d5ctta_: 5ctt A: [316220] automated match to d3knda_ protein/RNA complex |
PDB Entry: 5ctt (more details), 1.7 Å
SCOPe Domain Sequences for d5ctta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ctta_ a.118.1.1 (A:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl iekyfs
Timeline for d5ctta_: