SCOPe 2.08: Domain d5chrb_: 5chr B:

Lineage for d5chrb_ (5chr B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Amphitrite ornata [TaxId:129555] [189339] (47 PDB entries)

8. Domain d5chrb_: 5chr B: [316218]
   automated match to d3ixfa_
   complexed with 4nc, gol, hem, oxy, so4

Details for d5chrb_

PDB Entry: 5chr, 1.98 Å

PDB Description: dehaloperoxidase b in complex with substrate p-nitrocatechol

PDB Compounds: (B:) Dehaloperoxidase B

SCOPe Domain Sequences for d5chrb_:

Sequence; same for both SEQRES and ATOM records:

>d5chrb_ a.1.1.2 (B:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d5chrb_:

• d5chrb_ first appeared in SCOPe 2.06
  
• d5chrb_ appears in SCOPe 2.07