| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (42 species) not a true protein |
| Species Amphitrite ornata [TaxId:129555] [189339] (9 PDB entries) |
| Domain d5chra_: 5chr A: [316217] automated match to d3ixfa_ complexed with 4nc, gol, hem, oxy, so4 |
PDB Entry: 5chr (more details), 1.98 Å
SCOPe Domain Sequences for d5chra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5chra_ a.1.1.2 (A:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk
Timeline for d5chra_: