Lineage for d5chra_ (5chr A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978657Protein automated matches [190359] (42 species)
    not a true protein
  7. 1978660Species Amphitrite ornata [TaxId:129555] [189339] (9 PDB entries)
  8. 1978677Domain d5chra_: 5chr A: [316217]
    automated match to d3ixfa_
    complexed with 4nc, gol, hem, oxy, so4

Details for d5chra_

PDB Entry: 5chr (more details), 1.98 Å

PDB Description: dehaloperoxidase b in complex with substrate p-nitrocatechol
PDB Compounds: (A:) Dehaloperoxidase B

SCOPe Domain Sequences for d5chra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5chra_ a.1.1.2 (A:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d5chra_:

Click to download the PDB-style file with coordinates for d5chra_.
(The format of our PDB-style files is described here.)

Timeline for d5chra_: