Lineage for d1dlja3 (1dlj A:295-402)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68936Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 69068Superfamily c.26.3: UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain [52413] (1 family) (S)
  5. 69069Family c.26.3.1: UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain [52414] (1 protein)
  6. 69070Protein UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain [52415] (1 species)
  7. 69071Species Streptococcus pyogenes [TaxId:1314] [52416] (2 PDB entries)
  8. 69072Domain d1dlja3: 1dlj A:295-402 [31621]
    Other proteins in same PDB: d1dlja1, d1dlja2

Details for d1dlja3

PDB Entry: 1dlj (more details), 1.8 Å

PDB Description: the first structure of udp-glucose dehydrogenase (udpgdh) reveals the catalytic residues necessary for the two-fold oxidation

SCOP Domain Sequences for d1dlja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes}
akqiinvlkeqespvkvvgvyrlimksnsdnfresaikdvidilkskdikiiiyepmlnk
lesedqsvlvndlenfkkqaniivtnrydnelqdvknkvysrdifgrd

SCOP Domain Coordinates for d1dlja3:

Click to download the PDB-style file with coordinates for d1dlja3.
(The format of our PDB-style files is described here.)

Timeline for d1dlja3: