SCOPe 2.08: Domain d4zdpb_: 4zdp B:

Lineage for d4zdpb_ (4zdp B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.9: SepSecS-like [159704] (2 proteins)
   Pfam PF05889

6. Protein automated matches [254680] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255862] (4 PDB entries)

8. Domain d4zdpb_: 4zdp B: [316203]
   automated match to d3hl2c_
   protein/RNA complex; complexed with plr, po4; mutant

Details for d4zdpb_

PDB Entry: 4zdp, 2.7 Å

PDB Description: the crystal structure of y334c mutant of human sepsecs in complex with selenocysteine trna (trnasec)

PDB Compounds: (B:) O-phosphoseryl-tRNA(Sec) selenium transferase

SCOPe Domain Sequences for d4zdpb_:

Sequence; same for both SEQRES and ATOM records:

>d4zdpb_ c.67.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gcearrshehlirlllekgkcpengwdestlelflhelaimdsnnflgncgvgeregrva
salvarrhyrfihgigrsgdisavqpkaagssllnkitnslvldiiklagvhtvancfvv
pmatgmsltlcfltlrhkrpkakyiiwpridqkscfksmitagfepvvienvlegdelrt
dlkaveakvqelgpdcilcihsttscfaprvpdrleelavicanydiphivnnaygvqss
kcmhliqqgarvgridafvqsldknfmvpvggaiiagfndsfiqeiskmypgrasaspsl
dvlitllslgsngckkllkerkemfsylsnqikklseaynerllhtphnpislamtlktl
dehrdkavtqlgsmlftrqvsgarvvplgsmqtvsgytfrgfmshtnnypcaylnaasai
gmkmqdvdlfikrldrclkavrk

Timeline for d4zdpb_:

• d4zdpb_ first appeared in SCOPe 2.06
  
• d4zdpb_ appears in SCOPe 2.07