Lineage for d4zg0b_ (4zg0 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971788Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2971789Protein automated matches [191036] (17 species)
    not a true protein
  7. 2971924Species Mouse (Mus musculus) [TaxId:10090] [316181] (2 PDB entries)
  8. 2971928Domain d4zg0b_: 4zg0 B: [316199]
    automated match to d3kvha_

Details for d4zg0b_

PDB Entry: 4zg0 (more details), 2.01 Å

PDB Description: crystal structure of mouse syndesmos protein
PDB Compounds: (B:) Protein syndesmos

SCOPe Domain Sequences for d4zg0b_:

Sequence, based on SEQRES records: (download)

>d4zg0b_ d.113.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elkqisreeamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpggfv
drrfwsledglnrvlglglgglrlteadylsshltegphrvvahlyarqltleqlhavei
savhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkvlnmmpsek
laealasatekqkkale

Sequence, based on observed residues (ATOM records): (download)

>d4zg0b_ d.113.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elkqisreeamrlgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpggfvdr
rfwsledglnrvlglglgglrlteadylsshltegphrvvahlyarqltleqlhaveisa
vhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkvlnmmpsekla
ealasatekqkkale

SCOPe Domain Coordinates for d4zg0b_:

Click to download the PDB-style file with coordinates for d4zg0b_.
(The format of our PDB-style files is described here.)

Timeline for d4zg0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4zg0a_