Lineage for d5j04b2 (5j04 B:143-428)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2422501Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2422949Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2422950Protein automated matches [226923] (74 species)
    not a true protein
  7. 2423501Species Synechococcus elongatus [TaxId:269084] [261952] (2 PDB entries)
  8. 2423504Domain d5j04b2: 5j04 B:143-428 [316198]
    Other proteins in same PDB: d5j04a1, d5j04b1
    automated match to d4ropa2
    complexed with act, ca, mg, pep

Details for d5j04b2

PDB Entry: 5j04 (more details), 2.3 Å

PDB Description: crystal structure of enolase from synechococcus elongatus, complex with phosphoenolpyruvate
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d5j04b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j04b2 c.1.11.0 (B:143-428) automated matches {Synechococcus elongatus [TaxId: 269084]}
anvlpvpmmnvinggahadnnvdfqefmimpvgapsfkealrwgaevfhalakvlkdkgl
atgvgdeggfapnlgsnkealellltaieaagykpgeqvalamdvassefyknglytcdg
vshepagmigiladlvsqypivsiedglqeddwsnwktltqqlgstvqlvgddlfvtnpd
rlqsgieqgvgnavliklnqigtltetlrtidlatrsgyrsvishrsgetedttiadlav
atragqiktgslsrseriakynrllrieaalgenalyagaiglgpk

SCOPe Domain Coordinates for d5j04b2:

Click to download the PDB-style file with coordinates for d5j04b2.
(The format of our PDB-style files is described here.)

Timeline for d5j04b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j04b1