Lineage for d1ct9d1 (1ct9 D:193-516)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22501Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 22574Superfamily c.26.2: Adenine nucleotide alpha hydrolases [52402] (2 families) (S)
  5. 22575Family c.26.2.1: N-type ATP pyrophosphatases [52403] (3 proteins)
  6. 22576Protein Asparagine synthetase B, C-terminal domain [52408] (1 species)
  7. 22577Species Escherichia coli [TaxId:562] [52409] (1 PDB entry)
  8. 22581Domain d1ct9d1: 1ct9 D:193-516 [31619]
    Other proteins in same PDB: d1ct9a2, d1ct9b2, d1ct9c2, d1ct9d2

Details for d1ct9d1

PDB Entry: 1ct9 (more details), 2 Å

PDB Description: crystal structure of asparagine synthetase b from escherichia coli

SCOP Domain Sequences for d1ct9d1:

Sequence, based on SEQRES records: (download)

>d1ct9d1 c.26.2.1 (D:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli}
rdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldssiisaitkkyaar
rvedqerseawwpqlhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdvi
yhietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelhee
tvrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdkmcgngkmekhil
recfeaylpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqletarfrfpyntptsk
eaylyreifeelfplpsaaecvpg

Sequence, based on observed residues (ATOM records): (download)

>d1ct9d1 c.26.2.1 (D:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli}
rdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldssiisaitkkyaaq
lhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdviyhietydvttiras
tpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelheetvrkllalhmydca
rankamsawgvearvpfldkkfldvamrinpqdkmcgkmekhilrecfeaylpasvawrq
dgvgyswidtlkevaaqqvsdqqletarfrfpyntptskeaylyreifeelfplpsaaec
vpg

SCOP Domain Coordinates for d1ct9d1:

Click to download the PDB-style file with coordinates for d1ct9d1.
(The format of our PDB-style files is described here.)

Timeline for d1ct9d1: