Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
Protein Asparagine synthetase B, C-terminal domain [52408] (1 species) |
Species Escherichia coli [TaxId:562] [52409] (1 PDB entry) |
Domain d1ct9d1: 1ct9 D:193-516 [31619] Other proteins in same PDB: d1ct9a2, d1ct9b2, d1ct9c2, d1ct9d2 complexed with amp, cl, gln, ium has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ct9 (more details), 2 Å
SCOPe Domain Sequences for d1ct9d1:
Sequence, based on SEQRES records: (download)
>d1ct9d1 c.26.2.1 (D:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli [TaxId: 562]} rdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldssiisaitkkyaar rvedqerseawwpqlhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdvi yhietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelhee tvrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdkmcgngkmekhil recfeaylpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqletarfrfpyntptsk eaylyreifeelfplpsaaecvpg
>d1ct9d1 c.26.2.1 (D:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli [TaxId: 562]} rdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldssiisaitkkyaaq lhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdviyhietydvttiras tpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelheetvrkllalhmydca rankamsawgvearvpfldkkfldvamrinpqdkmcgkmekhilrecfeaylpasvawrq dgvgyswidtlkevaaqqvsdqqletarfrfpyntptskeaylyreifeelfplpsaaec vpg
Timeline for d1ct9d1: