Lineage for d1ct9c1 (1ct9 C:193-516)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2106293Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2106294Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 protein domains)
  6. 2106335Protein Asparagine synthetase B, C-terminal domain [52408] (1 species)
  7. 2106336Species Escherichia coli [TaxId:562] [52409] (1 PDB entry)
  8. 2106339Domain d1ct9c1: 1ct9 C:193-516 [31618]
    Other proteins in same PDB: d1ct9a2, d1ct9b2, d1ct9c2, d1ct9d2
    complexed with amp, cl, gln, ium

Details for d1ct9c1

PDB Entry: 1ct9 (more details), 2 Å

PDB Description: crystal structure of asparagine synthetase b from escherichia coli
PDB Compounds: (C:) asparagine synthetase b

SCOPe Domain Sequences for d1ct9c1:

Sequence, based on SEQRES records: (download)

>d1ct9c1 c.26.2.1 (C:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli [TaxId: 562]}
rdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldssiisaitkkyaar
rvedqerseawwpqlhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdvi
yhietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelhee
tvrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdkmcgngkmekhil
recfeaylpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqletarfrfpyntptsk
eaylyreifeelfplpsaaecvpg

Sequence, based on observed residues (ATOM records): (download)

>d1ct9c1 c.26.2.1 (C:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli [TaxId: 562]}
rdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldssiisaitkkyawp
qlhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdviyhietydvttira
stpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelheetvrkllalhmydc
arankamsawgvearvpfldkkfldvamrinpqdkmckmekhilrecfeaylpasvawrq
dgvgyswidtlkevaaqqvsdqqletarfrfpyntptskeaylyreifeelfplpsaaec
vpg

SCOPe Domain Coordinates for d1ct9c1:

Click to download the PDB-style file with coordinates for d1ct9c1.
(The format of our PDB-style files is described here.)

Timeline for d1ct9c1: