Lineage for d4zyza_ (4zyz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892512Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2892519Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 2892541Species Human (Homo sapiens) [TaxId:9606] [82468] (30 PDB entries)
  8. 2892548Domain d4zyza_: 4zyz A: [316177]
    automated match to d4zz1a_
    complexed with 3yd, gar

Details for d4zyza_

PDB Entry: 4zyz (more details), 1.6 Å

PDB Description: human gar transformylase in complex with gar and (s)-2-(7-(2-amino-4- oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)heptanamido) pentanedioic acid (agf145)
PDB Compounds: (A:) Trifunctional purine biosynthetic protein adenosine-3

SCOPe Domain Sequences for d4zyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zyza_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwv

SCOPe Domain Coordinates for d4zyza_:

Click to download the PDB-style file with coordinates for d4zyza_.
(The format of our PDB-style files is described here.)

Timeline for d4zyza_: