SCOPe 2.08: Domain d5i86b_: 5i86 B:

Lineage for d5i86b_ (5i86 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein CREB-binding protein, CBP [74712] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)

8. Domain d5i86b_: 5i86 B: [316172]
   automated match to d4nyxa_
   complexed with 69a, edo, scn

Details for d5i86b_

PDB Entry: 5i86, 1.05 Å

PDB Description: crystal structure of the bromodomain of human crebbp bound to the benzodiazepinone g02778174

PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d5i86b_:

Sequence; same for both SEQRES and ATOM records:

>d5i86b_ a.29.2.1 (B:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

Timeline for d5i86b_:

• d5i86b_ first appeared in SCOPe 2.06
  
• d5i86b_ appears in SCOPe 2.07