Lineage for d5ec1b2 (5ec1 B:108-209)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (554 PDB entries)
  8. 2354462Domain d5ec1b2: 5ec1 B:108-209 [316156]
    Other proteins in same PDB: d5ec1a1, d5ec1a2, d5ec1a3, d5ec1b1, d5ec1c_
    automated match to d4h88l2
    complexed with dga, f09, k; mutant

Details for d5ec1b2

PDB Entry: 5ec1 (more details), 2.75 Å

PDB Description: kcsa with v76ester mutation
PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d5ec1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ec1b2 b.1.1.2 (B:108-209) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksf

SCOPe Domain Coordinates for d5ec1b2:

Click to download the PDB-style file with coordinates for d5ec1b2.
(The format of our PDB-style files is described here.)

Timeline for d5ec1b2: