Lineage for d2n1wa_ (2n1w A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2178112Protein automated matches [190118] (12 species)
    not a true protein
  7. 2178143Species Human (Homo sapiens) [TaxId:9606] [189560] (94 PDB entries)
  8. 2178309Domain d2n1wa_: 2n1w A: [316152]
    automated match to d2awta_

Details for d2n1wa_

PDB Entry: 2n1w (more details)

PDB Description: solution structure of human sumo2
PDB Compounds: (A:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d2n1wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n1wa_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
rfdgqpinetdtpaqlemededtidvfqqqtgg

SCOPe Domain Coordinates for d2n1wa_:

Click to download the PDB-style file with coordinates for d2n1wa_.
(The format of our PDB-style files is described here.)

Timeline for d2n1wa_: