| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
| Protein NH3-dependent NAD+-synthetase [52406] (4 species) |
| Species Bacillus subtilis [TaxId:1423] [52407] (7 PDB entries) |
| Domain d1nsyb_: 1nsy B: [31615] complexed with amp, atp, mg, pop |
PDB Entry: 1nsy (more details), 2 Å
SCOPe Domain Sequences for d1nsyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nsyb_ c.26.2.1 (B:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk
Timeline for d1nsyb_: