Lineage for d4zdlb_ (4zdl B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896641Family c.67.1.9: SepSecS-like [159704] (2 proteins)
    Pfam PF05889
  6. 2896657Protein automated matches [254680] (1 species)
    not a true protein
  7. 2896658Species Human (Homo sapiens) [TaxId:9606] [255862] (4 PDB entries)
  8. 2896660Domain d4zdlb_: 4zdl B: [316148]
    automated match to d3hl2c_
    complexed with flc, plr; mutant

Details for d4zdlb_

PDB Entry: 4zdl (more details), 2.26 Å

PDB Description: the crystal structure of the t325s mutant of the human holo sepsecs
PDB Compounds: (B:) O-phosphoseryl-tRNA(Sec) selenium transferase

SCOPe Domain Sequences for d4zdlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zdlb_ c.67.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqgcearrshehlirlllekgkcpengwdestlelflhelaimdsnnflgncgvgeregr
vasalvarrhyrfihgigrsgdisavqpkaagssllnkitnslvldiiklagvhtvancf
vvpmatgmsltlcfltlrhkrpkakyiiwpridqkscfksmitagfepvvienvlegdel
rtdlkaveakvqelgpdcilcihsttscfaprvpdrleelavicanydiphivnnaygvq
sskcmhliqqgarvgridafvqsldknfmvpvggaiiagfndsfiqeiskmypgrasasp
sldvlisllslgsngykkllkerkemfsylsnqikklseaynerllhtphnpislamtlk
tldehrdkavtqlgsmlftrqvsgarvvplgsmqtvsgytfrgfmshtnnypcaylnaas
aigmkmqdvdlfikrldrclkavr

SCOPe Domain Coordinates for d4zdlb_:

Click to download the PDB-style file with coordinates for d4zdlb_.
(The format of our PDB-style files is described here.)

Timeline for d4zdlb_: