Lineage for d4yk0d_ (4yk0 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316814Family a.29.2.1: Bromodomain [47371] (6 protein domains)
  6. 2316815Protein CREB-binding protein, CBP [74712] (1 species)
  7. 2316816Species Human (Homo sapiens) [TaxId:9606] [74713] (36 PDB entries)
  8. 2316849Domain d4yk0d_: 4yk0 D: [316138]
    automated match to d4nyva_
    complexed with 98, edo

Details for d4yk0d_

PDB Entry: 4yk0 (more details), 1.65 Å

PDB Description: crystal structure of the cbp bromodomain in complex with cpi098
PDB Compounds: (D:) creb-binding protein

SCOPe Domain Sequences for d4yk0d_:

Sequence, based on SEQRES records: (download)

>d4yk0d_ a.29.2.1 (D:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
mptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldtgqyqepwqyv
ddvwlmfnnawlynrktsrvykfcsklaevfeq

Sequence, based on observed residues (ATOM records): (download)

>d4yk0d_ a.29.2.1 (D:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
mptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldtgqypwqyvdd
vwlmfnnawlynrktsrvykfcsklaevfeq

SCOPe Domain Coordinates for d4yk0d_:

Click to download the PDB-style file with coordinates for d4yk0d_.
(The format of our PDB-style files is described here.)

Timeline for d4yk0d_: