| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
| Protein automated matches [226842] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
| Domain d4s0uc_: 4s0u C: [316137] Other proteins in same PDB: d4s0ua_, d4s0ub_ automated match to d1kcgc_ |
PDB Entry: 4s0u (more details), 2.35 Å
SCOPe Domain Sequences for d4s0uc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s0uc_ d.19.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dphslsyditvipkfrpgprwcavqgqvdektflhydcgnktvtpvsplgkklnvtmawk
aqnpvlrevvdilteqlldiqlenytpkepltlqarmsceqkaeghssgswqfsidgqtf
llfdsekrmwttvhpgarkmkekwendkdvamsfhyismgdcigwledflmgmds
Timeline for d4s0uc_: