Lineage for d4s0uc_ (4s0u C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938835Domain d4s0uc_: 4s0u C: [316137]
    Other proteins in same PDB: d4s0ua_, d4s0ub_
    automated match to d1kcgc_

Details for d4s0uc_

PDB Entry: 4s0u (more details), 2.35 Å

PDB Description: crystal structure of nkg2d in complex with ulbp6
PDB Compounds: (C:) Retinoic acid early transcript 1L protein

SCOPe Domain Sequences for d4s0uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s0uc_ d.19.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dphslsyditvipkfrpgprwcavqgqvdektflhydcgnktvtpvsplgkklnvtmawk
aqnpvlrevvdilteqlldiqlenytpkepltlqarmsceqkaeghssgswqfsidgqtf
llfdsekrmwttvhpgarkmkekwendkdvamsfhyismgdcigwledflmgmds

SCOPe Domain Coordinates for d4s0uc_:

Click to download the PDB-style file with coordinates for d4s0uc_.
(The format of our PDB-style files is described here.)

Timeline for d4s0uc_: