![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
![]() | Protein NH3-dependent NAD+-synthetase [52406] (4 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [52407] (7 PDB entries) |
![]() | Domain d2nsyb_: 2nsy B: [31613] complexed with amp, gol, mg, nad, pop |
PDB Entry: 2nsy (more details), 2 Å
SCOPe Domain Sequences for d2nsyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nsyb_ c.26.2.1 (B:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]} smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev sakvsealekrysmtehkrqvpasmfddwwk
Timeline for d2nsyb_: