SCOP 1.67: Domain d2nsyb_: 2nsy B:

Lineage for d2nsyb_ (2nsy B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins)

6. Protein NH3-dependent NAD+-synthetase [52406] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [52407] (7 PDB entries)

8. Domain d2nsyb_: 2nsy B: [31613]
   complexed with adn, cry, mg, pop

Details for d2nsyb_

PDB Entry: 2nsy, 2 Å

PDB Description: crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis in complex with nad-adenylate

SCOP Domain Sequences for d2nsyb_:

Sequence; same for both SEQRES and ATOM records:

>d2nsyb_ c.26.2.1 (B:) NH3-dependent NAD+-synthetase {Bacillus subtilis}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk

Timeline for d2nsyb_:

• d2nsyb_ first appeared (with stable ids) in SCOP 1.55
  
• d2nsyb_ appears in SCOP 1.65
  
• d2nsyb_ appears in SCOP 1.69
  
• d2nsyb_ appears in the current release, SCOPe 2.08