Lineage for d2nsya_ (2nsy A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482378Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 482696Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 482697Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins)
  6. 482771Protein NH3-dependent NAD+-synthetase [52406] (1 species)
  7. 482772Species Bacillus subtilis [TaxId:1423] [52407] (7 PDB entries)
  8. 482785Domain d2nsya_: 2nsy A: [31612]

Details for d2nsya_

PDB Entry: 2nsy (more details), 2 Å

PDB Description: crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis in complex with nad-adenylate

SCOP Domain Sequences for d2nsya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nsya_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk

SCOP Domain Coordinates for d2nsya_:

Click to download the PDB-style file with coordinates for d2nsya_.
(The format of our PDB-style files is described here.)

Timeline for d2nsya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nsyb_